Lineage for d4wesc_ (4wes C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2519619Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2519730Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2519806Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
    automatically mapped to Pfam PF00148
  6. 2519999Protein automated matches [190199] (3 species)
    not a true protein
  7. 2520053Species Clostridium pasteurianum [TaxId:1262449] [269442] (1 PDB entry)
  8. 2520055Domain d4wesc_: 4wes C: [269444]
    Other proteins in same PDB: d4wesb_, d4wesd_
    automated match to d1mioa_
    complexed with clf, fe2, hca, ics, mpd

Details for d4wesc_

PDB Entry: 4wes (more details), 1.08 Å

PDB Description: nitrogenase molybdenum-iron protein from clostridium pasteurianum at 1.08 a resolution
PDB Compounds: (C:) nitrogenase molybdenum-iron protein alpha chain

SCOPe Domain Sequences for d4wesc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wesc_ c.92.2.3 (C:) automated matches {Clostridium pasteurianum [TaxId: 1262449]}
enlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgvv
mgpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvnk
lkdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvsq
saghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatltg
datyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmakc
fddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvds
lvagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkagv
plssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskqlh
sydyngpyagfrgvvnfghelvngiytpawkmitppwk

SCOPe Domain Coordinates for d4wesc_:

Click to download the PDB-style file with coordinates for d4wesc_.
(The format of our PDB-style files is described here.)

Timeline for d4wesc_: