Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) contains a long alpha helical insertion in the interdomain linker |
Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins) contains three domains of this fold; "Helical backbone" holds domains 2 and 3 both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3 automatically mapped to Pfam PF00148 |
Protein automated matches [190199] (3 species) not a true protein |
Species Clostridium pasteurianum [TaxId:1262449] [269442] (1 PDB entry) |
Domain d4wesc_: 4wes C: [269444] Other proteins in same PDB: d4wesb_, d4wesd_ automated match to d1mioa_ complexed with clf, fe2, hca, ics, mpd |
PDB Entry: 4wes (more details), 1.08 Å
SCOPe Domain Sequences for d4wesc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wesc_ c.92.2.3 (C:) automated matches {Clostridium pasteurianum [TaxId: 1262449]} enlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgvv mgpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvnk lkdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvsq saghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatltg datyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmakc fddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvds lvagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkagv plssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskqlh sydyngpyagfrgvvnfghelvngiytpawkmitppwk
Timeline for d4wesc_: