![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
![]() | Protein automated matches [190976] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries) |
![]() | Domain d4s0sd_: 4s0s D: [269365] Other proteins in same PDB: d4s0sa_, d4s0sb_ automated match to d4ov6f_ |
PDB Entry: 4s0s (more details), 2.8 Å
SCOPe Domain Sequences for d4s0sd_:
Sequence, based on SEQRES records: (download)
>d4s0sd_ b.1.2.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlevvaatptslliswpppyyvegvtvfritygetggnspvqeftvpywtetatisglkp gvdytitvyaemypgspwagqvmdiqpisinyrt
>d4s0sd_ b.1.2.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlevvaatptslliswpppyyvegvtvfritygetggnspvqeftvpywtetatisglkp gvdytitvyaemypgspwmdiqpisinyrt
Timeline for d4s0sd_: