Lineage for d4s0sd_ (4s0s D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2762239Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2762240Protein automated matches [190976] (5 species)
    not a true protein
  7. 2762264Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)
  8. 2762360Domain d4s0sd_: 4s0s D: [269365]
    Other proteins in same PDB: d4s0sa_, d4s0sb_
    automated match to d4ov6f_

Details for d4s0sd_

PDB Entry: 4s0s (more details), 2.8 Å

PDB Description: structure of human pregnane x receptor ligand binding domain with adnectin-1
PDB Compounds: (D:) Adnectin-1

SCOPe Domain Sequences for d4s0sd_:

Sequence, based on SEQRES records: (download)

>d4s0sd_ b.1.2.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlevvaatptslliswpppyyvegvtvfritygetggnspvqeftvpywtetatisglkp
gvdytitvyaemypgspwagqvmdiqpisinyrt

Sequence, based on observed residues (ATOM records): (download)

>d4s0sd_ b.1.2.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlevvaatptslliswpppyyvegvtvfritygetggnspvqeftvpywtetatisglkp
gvdytitvyaemypgspwmdiqpisinyrt

SCOPe Domain Coordinates for d4s0sd_:

Click to download the PDB-style file with coordinates for d4s0sd_.
(The format of our PDB-style files is described here.)

Timeline for d4s0sd_: