Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.0: automated matches [191327] (1 protein) not a true family |
Protein automated matches [190150] (34 species) not a true protein |
Species Vulcanisaeta moutnovskia [TaxId:985053] [269342] (3 PDB entries) |
Domain d4re0a_: 4re0 A: [269347] automated match to d4g2da_ complexed with co, gol, myr, so4 |
PDB Entry: 4re0 (more details), 2.35 Å
SCOPe Domain Sequences for d4re0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4re0a_ c.1.9.0 (A:) automated matches {Vulcanisaeta moutnovskia [TaxId: 985053]} mvrisiaggneidpgsmgltlfhehlrlitevvrwnwphlynedeelkraidavnaakky gvktiidltvagigcdvrfnekvakatgvniimgtgfytyteipfyfknrgidslvdafv hditigiqgtntraafvkavidssgltkdvemairaaakahiktdvpiithsfvgnkssl dlirifkeegvdlartvighvgdtddisfieqilregafigldrfgldiylpldkrvkta ielikrgwidqlllshdycptidwyppevvrstvpdwtmtlifekviprmrsegiteeqi nrvlidnprrlftg
Timeline for d4re0a_: