SCOPe 2.08: Domain d4xgie1: 4xgi E:13-197

Lineage for d4xgie1 (4xgi E:13-197)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (40 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [269204] (1 PDB entry)

8. Domain d4xgie1: 4xgi E:13-197 [269207]
   Other proteins in same PDB: d4xgia2, d4xgib2, d4xgic2, d4xgid2, d4xgie2, d4xgif2
   automated match to d1euza2
   complexed with akg, edo, nad

Details for d4xgie1

PDB Entry: 4xgi, 2 Å

PDB Description: crystal structure of glutamate dehydrogenase from burkholderia thailandensis

PDB Compounds: (E:) glutamate dehydrogenase

SCOPe Domain Sequences for d4xgie1:

Sequence; same for both SEQRES and ATOM records:

>d4xgie1 c.58.1.0 (E:13-197) automated matches {Burkholderia thailandensis [TaxId: 271848]}
sipsylhaddlgpwgnylqqvdrvapylgslsrwietlkrpkrilivdvpieldngtvah
fegyrvqhnvsrgpgkggvryhqdvtlsevmalsawmsvknaavnvpyggakggirvdpr
klsrgelervtrrytseigiiigpntdipapdvntneqimawmmdtysmnqgqtatgvvt
gkpis

Timeline for d4xgie1:

• d4xgie1 first appeared in SCOPe 2.05
  
• d4xgie1 appears in SCOPe 2.07