Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
Protein automated matches [226864] (38 species) not a true protein |
Species Burkholderia thailandensis [TaxId:271848] [269204] (1 PDB entry) |
Domain d4xgie1: 4xgi E:13-197 [269207] Other proteins in same PDB: d4xgia2, d4xgib2, d4xgic2, d4xgid2, d4xgie2, d4xgif2 automated match to d1euza2 complexed with akg, edo, nad |
PDB Entry: 4xgi (more details), 2 Å
SCOPe Domain Sequences for d4xgie1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xgie1 c.58.1.0 (E:13-197) automated matches {Burkholderia thailandensis [TaxId: 271848]} sipsylhaddlgpwgnylqqvdrvapylgslsrwietlkrpkrilivdvpieldngtvah fegyrvqhnvsrgpgkggvryhqdvtlsevmalsawmsvknaavnvpyggakggirvdpr klsrgelervtrrytseigiiigpntdipapdvntneqimawmmdtysmnqgqtatgvvt gkpis
Timeline for d4xgie1: