Lineage for d4xfja2 (4xfj A:173-398)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2238889Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily)
    unusual fold
  4. 2238890Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families) (S)
  5. 2238936Family d.210.1.0: automated matches [227194] (1 protein)
    not a true family
  6. 2238937Protein automated matches [226921] (3 species)
    not a true protein
  7. 2238942Species Mycobacterium thermoresistibile [TaxId:1078020] [260071] (2 PDB entries)
  8. 2238943Domain d4xfja2: 4xfj A:173-398 [269190]
    Other proteins in same PDB: d4xfja1, d4xfjb1
    automated match to d4u7ja2
    complexed with anp, arg, edo, mg

Details for d4xfja2

PDB Entry: 4xfj (more details), 1.55 Å

PDB Description: crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile in complex with amppnp and arginine
PDB Compounds: (A:) argininosuccinate synthase

SCOPe Domain Sequences for d4xfja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xfja2 d.210.1.0 (A:173-398) automated matches {Mycobacterium thermoresistibile [TaxId: 1078020]}
pfsidqnvwgravetgflehlwnaptkdvysytedptvnwstpdevivgfeqgvpvsidg
rsvtplqaieelnrrggeqgvgrldvvedrlvgiksreiyeapgamvlitahtelehvtl
erelgrfkritdqkwgelvydglwfsplktalesfvaktqehvtgeirmvlhgghiavng
rrspkslydfnlatydegdtfdqsaakgfvqihglsssisarrdlq

SCOPe Domain Coordinates for d4xfja2:

Click to download the PDB-style file with coordinates for d4xfja2.
(The format of our PDB-style files is described here.)

Timeline for d4xfja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xfja1