Lineage for d4x9pa_ (4x9p A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000010Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2000011Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2000012Family a.65.1.1: Annexin [47875] (10 protein domains)
  6. 2000024Protein Annexin II [116947] (2 species)
  7. 2000025Species Cow (Bos taurus) [TaxId:9913] [269166] (1 PDB entry)
  8. 2000026Domain d4x9pa_: 4x9p A: [269167]
    automated match to d1w7ba_
    complexed with ca, cl

Details for d4x9pa_

PDB Entry: 4x9p (more details), 2.01 Å

PDB Description: crystal structure of bovine annexin a2
PDB Compounds: (A:) annexin a2

SCOPe Domain Sequences for d4x9pa_:

Sequence, based on SEQRES records: (download)

>d4x9pa_ a.65.1.1 (A:) Annexin II {Cow (Bos taurus) [TaxId: 9913]}
saygsvkaytnfdaerdalnietaiktkgvdevtivniltnrsneqrqdiafayqrrtkk
elasalksalsghletvilgllktpaqydaselkasmkglgtdedslieiicsrtnqelq
einrvykemyktdlekdivsdtsgdfrklmvalakgrraedgsvidyelidqdardlyda
gvkrkgtdvpkwisimtersvchlqkvferyksyspydmlesikkevkgdlenaflnlvq
ciqnkplyfadrlydsmkgkgtrdkvlirimvsrsevdmlkirsefkkkygkslyyyiqq
dtkgdyqkallylcggdd

Sequence, based on observed residues (ATOM records): (download)

>d4x9pa_ a.65.1.1 (A:) Annexin II {Cow (Bos taurus) [TaxId: 9913]}
saygsvkaytnfdaerdalnietaiktkgvdevtivniltnrsneqrqdiafayqrrtkk
elasalksalsghletvilgllktpaqydaselkasmtdedslieiicsrtnqelqeinr
vykemyktdlekdivsdtsgdfrklmvalakgrraedgsvidyelidqdardlydagvkr
kgtdvpkwisimtersvchlqkvferyksyspydmlesikkevkgdlenaflnlvqciqn
kplyfadrlydsmkgkgtrdkvlirimvsrsevdmlkirsefkkkygkslyyyiqqdtkg
dyqkallylcggdd

SCOPe Domain Coordinates for d4x9pa_:

Click to download the PDB-style file with coordinates for d4x9pa_.
(The format of our PDB-style files is described here.)

Timeline for d4x9pa_: