SCOP 1.69: Domain d1bw3__: 1bw3 -

Lineage for d1bw3__ (1bw3 -)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.1: Barwin-like endoglucanases [50685] (3 families)

5. Family b.52.1.2: Barwin [50689] (1 protein)

6. Protein Barwin [50690] (1 species)

7. Species Barley (Hordeum vulgare) [TaxId:4513] [50691] (2 PDB entries)

8. Domain d1bw3__: 1bw3 - [26899]

Details for d1bw3__

PDB Entry: 1bw3

PDB Description: three-dimensional structure in solution of barwin, a protein from barley seed

SCOP Domain Sequences for d1bw3__:

Sequence; same for both SEQRES and ATOM records:

>d1bw3__ b.52.1.2 (-) Barwin {Barley (Hordeum vulgare)}
eqandvratyhyyrpaqnnwdlgapavsaycatwdaskplswrskygwtafcgpagprgq
aacgkclrvtnpatgaqitarivdqcanggldldwdtvftkidtngigyqqghlnvnyqf
vdcrd

Timeline for d1bw3__:

• d1bw3__ first appeared (with stable ids) in SCOP 1.55
  
• d1bw3__ appears in SCOP 1.67
  
• d1bw3__ appears in SCOP 1.71
  
• d1bw3__ appears in the current release, SCOPe 2.08, called d1bw3a_