Lineage for d4uxag_ (4uxa G:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2424649Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2424650Protein automated matches [190388] (31 species)
    not a true protein
  7. 2424708Species Granulicella tundricola [TaxId:940615] [268964] (1 PDB entry)
  8. 2424715Domain d4uxag_: 4uxa G: [268980]
    automated match to d4bifa_
    complexed with mn

Details for d4uxag_

PDB Entry: 4uxa (more details), 2.1 Å

PDB Description: Improved variant of (R)-selective manganese-dependent hydroxynitrile lyase from bacteria
PDB Compounds: (G:) Cupin 2 conserved barrel domain protein

SCOPe Domain Sequences for d4uxag_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uxag_ b.82.1.0 (G:) automated matches {Granulicella tundricola [TaxId: 940615]}
meikrvgsqasgkgpadwftgtvridplfqapdpalvaghsttfepgartawhthplgqt
livtagcgwaqreggaveeihpgdvvwfspgekhwhgaapttamthlaiherldgkavdw
mehvtdeqyrr

SCOPe Domain Coordinates for d4uxag_:

Click to download the PDB-style file with coordinates for d4uxag_.
(The format of our PDB-style files is described here.)

Timeline for d4uxag_: