SCOP 1.73: Domain d1ilea2: 1ile A:198-386

Lineage for d1ilea2 (1ile A:198-386)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
   core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel

4. Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family)

5. Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (3 proteins)
   inserted into the catalytic domain

6. Protein Isoleucyl-tRNA synthetase (IleRS) [50679] (2 species)

7. Species Thermus thermophilus [TaxId:274] [50680] (5 PDB entries)

8. Domain d1ilea2: 1ile A:198-386 [26889]
   Other proteins in same PDB: d1ilea1, d1ilea3
   complexed with zn

Details for d1ilea2

PDB Entry: 1ile, 2.5 Å

PDB Description: isoleucyl-trna synthetase

PDB Compounds: (A:) isoleucyl-tRNA synthetase

SCOP Domain Sequences for d1ilea2:

Sequence; same for both SEQRES and ATOM records:

>d1ilea2 b.51.1.1 (A:198-386) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus [TaxId: 274]}
keiqdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdea
lileeglgrkllgegtqvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgi
vhqapafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgllf
keesylhsy

Timeline for d1ilea2:

• d1ilea2 first appeared (with stable ids) in SCOP 1.55, called d1ile_2
  
• d1ilea2 was called d1ile_2 in SCOP 1.71
  
• d1ilea2 appears in SCOP 1.75
  
• d1ilea2 appears in the current release, SCOPe 2.08