Lineage for d1ile_2 (1ile 198-386)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.51: ValRS/IleRS editing domain [50676] (1 superfamily) Superfamily b.51.1: ValRS/IleRS editing domain [50677] (1 family) 
Family b.51.1.1: ValRS/IleRS editing domain [50678] (2 proteins) Protein Isoleucyl-tRNA synthetase (IleRS) [50679] (2 species) 
Species Thermus thermophilus [TaxId:274] [50680] (1 PDB entry) 
Domain d1ile_2: 1ile 198-386 [26889]
Other proteins in same PDB: d1ile_1, d1ile_3
Details for d1ile_2
PDB Entry: 1ile (more details), 2.5 Å
PDB Description: isoleucyl-trna synthetase
SCOP Domain Sequences for d1ile_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ile_2 b.51.1.1 (198-386) Isoleucyl-tRNA synthetase (IleRS) {Thermus thermophilus}
keiqdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdea
lileeglgrkllgegtqvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgi
vhqapafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgllf
keesylhsy
SCOP Domain Coordinates for d1ile_2:
Click to download the PDB-style file with coordinates for d1ile_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ile_2:
- d1ile_2 appears in SCOP 1.57
- d1ile_2 appears in the current release, SCOPe 2.08, called d1ilea2
View in 3D
