SCOPe 2.05: Domain d4s17b1: 4s17 B:4-105

Lineage for d4s17b1 (4s17 B:4-105)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families)
   automatically mapped to Pfam PF03951

5. Family d.15.9.0: automated matches [227156] (1 protein)
   not a true family

6. Protein automated matches [226862] (4 species)
   not a true protein

7. Species Bifidobacterium adolescentis [TaxId:367928] [268844] (1 PDB entry)

8. Domain d4s17b1: 4s17 B:4-105 [268853]
   Other proteins in same PDB: d4s17a2, d4s17b2, d4s17c2, d4s17d2, d4s17e2, d4s17f2
   automated match to d1htqa1
   complexed with act, mg

Details for d4s17b1

PDB Entry: 4s17, 2.3 Å

PDB Description: the crystal structure of glutamine synthetase from bifidobacterium adolescentis atcc 15703

PDB Compounds: (B:) glutamine synthetase

SCOPe Domain Sequences for d4s17b1:

Sequence, based on SEQRES records:

>d4s17b1 d.15.9.0 (B:4-105) automated matches {Bifidobacterium adolescentis [TaxId: 367928]}
letkadaealinkegieyvsvrftdligvqqhftvpaseflkdaftdgmpfdgssvegfq
ainesdmklvpdvstafidpfrkhktldvafsivdpltdepy

Sequence, based on observed residues (ATOM records):

>d4s17b1 d.15.9.0 (B:4-105) automated matches {Bifidobacterium adolescentis [TaxId: 367928]}
letkadaealinkegieyvsvrftdligvqqhftvpaseflkdaftdgmpfdgssvegfq
sdmklvpdvstafidpfrkhktldvafsivdpltdepy

Timeline for d4s17b1:

• d4s17b1 is new in SCOPe 2.05-stable
  
• d4s17b1 appears in SCOPe 2.06
  
• d4s17b1 appears in the current release, SCOPe 2.08