| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) ![]() automatically mapped to Pfam PF03951 |
| Family d.15.9.0: automated matches [227156] (1 protein) not a true family |
| Protein automated matches [226862] (5 species) not a true protein |
| Species Bifidobacterium adolescentis [TaxId:367928] [268844] (1 PDB entry) |
| Domain d4s17b1: 4s17 B:4-105 [268853] Other proteins in same PDB: d4s17a2, d4s17b2, d4s17c2, d4s17d2, d4s17e2, d4s17f2 automated match to d1htqa1 complexed with act, mg |
PDB Entry: 4s17 (more details), 2.3 Å
SCOPe Domain Sequences for d4s17b1:
Sequence, based on SEQRES records: (download)
>d4s17b1 d.15.9.0 (B:4-105) automated matches {Bifidobacterium adolescentis [TaxId: 367928]}
letkadaealinkegieyvsvrftdligvqqhftvpaseflkdaftdgmpfdgssvegfq
ainesdmklvpdvstafidpfrkhktldvafsivdpltdepy
>d4s17b1 d.15.9.0 (B:4-105) automated matches {Bifidobacterium adolescentis [TaxId: 367928]}
letkadaealinkegieyvsvrftdligvqqhftvpaseflkdaftdgmpfdgssvegfq
sdmklvpdvstafidpfrkhktldvafsivdpltdepy
Timeline for d4s17b1: