Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
Protein automated matches [190646] (70 species) not a true protein |
Species Verminephrobacter eiseniae [TaxId:391735] [268821] (1 PDB entry) |
Domain d4ry9b_: 4ry9 B: [268827] automated match to d2fn8a_ complexed with bct, gol, tlz |
PDB Entry: 4ry9 (more details), 1.4 Å
SCOPe Domain Sequences for d4ry9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ry9b_ c.93.1.0 (B:) automated matches {Verminephrobacter eiseniae [TaxId: 391735]} gafkigvsmktlsapyfaaqmeaakargkelgyevlatdaqgklqkqisdvedlvtrgvk lliinpadseglvnavnnasangvkvvvidstlnpranfvtqvqssnsingalvghwvie evgnkslkiallsgekgnpvgqerrlgvlsgiieaqlrkfgkadltvvgqgwghwndegg lkamedllvankdinmvlgendsmvlgarraiesagrtgillvaaadaqkealalikqgk ygvtglndpalvartaidlgvkvvkgevkdvpkqtlttpaaitkgnvdkfynpkavf
Timeline for d4ry9b_: