SCOPe 2.06: Domain d4ry9b_: 4ry9 B:

Lineage for d4ry9b_ (4ry9 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (70 species)
   not a true protein

7. Species Verminephrobacter eiseniae [TaxId:391735] [268821] (1 PDB entry)

8. Domain d4ry9b_: 4ry9 B: [268827]
   automated match to d2fn8a_
   complexed with bct, gol, tlz

Details for d4ry9b_

PDB Entry: 4ry9, 1.4 Å

PDB Description: crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol

PDB Compounds: (B:) Periplasmic binding protein/LacI transcriptional regulator

SCOPe Domain Sequences for d4ry9b_:

Sequence; same for both SEQRES and ATOM records:

>d4ry9b_ c.93.1.0 (B:) automated matches {Verminephrobacter eiseniae [TaxId: 391735]}
gafkigvsmktlsapyfaaqmeaakargkelgyevlatdaqgklqkqisdvedlvtrgvk
lliinpadseglvnavnnasangvkvvvidstlnpranfvtqvqssnsingalvghwvie
evgnkslkiallsgekgnpvgqerrlgvlsgiieaqlrkfgkadltvvgqgwghwndegg
lkamedllvankdinmvlgendsmvlgarraiesagrtgillvaaadaqkealalikqgk
ygvtglndpalvartaidlgvkvvkgevkdvpkqtlttpaaitkgnvdkfynpkavf

Timeline for d4ry9b_:

• d4ry9b_ first appeared in SCOPe 2.05
  
• d4ry9b_ appears in SCOPe 2.07
  
• d4ry9b_ appears in the current release, SCOPe 2.08