Lineage for d4qd4b_ (4qd4 B:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1950340Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 1950341Protein automated matches [190857] (31 species)
    not a true protein
  7. 1950342Species Acinetobacter baumannii [TaxId:470] [194613] (31 PDB entries)
  8. 1950356Domain d4qd4b_: 4qd4 B: [268608]
    automated match to d4neta_
    complexed with cit, mes

Details for d4qd4b_

PDB Entry: 4qd4 (more details), 1.8 Å

PDB Description: Structure of ADC-68, a Novel Carbapenem-Hydrolyzing Class C Extended-Spectrum -Lactamase from Acinetobacter baumannii
PDB Compounds: (B:) Beta-lactamase ADC-68

SCOPe Domain Sequences for d4qd4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qd4b_ e.3.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]}
pkdqeikklvdqnfkpllekydvpgmavgviqnnkkyemyyglqsvqdkkavnsstifel
gsvsklftatagayaknkgkisfddtpgkywkelkntpidqvnllqlatytsgnlalqfp
devqtdqqvltffkdwkpknpigeyrqysnpsiglfgkvvalsmnkpfdqvlekiifpal
glkhsyvnvaktqmqnyafgynqenqpirvnpgpldapaygvkstlpdmlsfihanlnpq
kypadiqrainethqgryqvntmyqalgweefsypatlqtlldsnseqivmkpnkvtais
kepsvkmyhktgstngfgtyvvfipkeniglvmltnkripneerikaayavlnaikk

SCOPe Domain Coordinates for d4qd4b_:

Click to download the PDB-style file with coordinates for d4qd4b_.
(The format of our PDB-style files is described here.)

Timeline for d4qd4b_: