SCOP 1.57: Domain d1lyb.2: 1lyb C:,D:

Lineage for d1lyb.2 (1lyb C:,D:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.2: Pepsin-like [50646] (9 proteins)

6. Protein Cathepsin D [50665] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50666] (3 PDB entries)

8. Domain d1lyb.2: 1lyb C:,D: [26858]

Details for d1lyb.2

PDB Entry: 1lyb, 2.5 Å

PDB Description: crystal structures of native and inhibited forms of human cathepsin d: implications for lysosomal targeting and drug design

SCOP Domain Sequences for d1lyb.2:

Sequence; same for both SEQRES and ATOM records:

>g1lyb.2 b.50.1.2 (C:,D:) Cathepsin D {Human (Homo sapiens)}
gpipevlknymdaqyygeigigtppqcftvvfdtgssnlwvpsihcklldiacwihhkyn
sdksstyvkngtsfdihygsgslsgylsqdtvsvpcqXggvkverqvfgeatkqpgitfi
aakfdgilgmayprisvnnvlpvfdnlmqqklvdqnifsfylsrdpdaqpggelmlggtd
skyykgslsylnvtrkaywqvhldqvevasgltlckegceaivdtgtslmvgpvdevrel
qkaigavpliqgeymipcekvstlpaitlklggkgyklspedytlkvsqagktlclsgfm
gmdipppsgplwilgdvfigryytvfdrdnnrvgfaeaa

Timeline for d1lyb.2:

• d1lyb.2 first appeared (with stable ids) in SCOP 1.55
  
• d1lyb.2 appears in SCOP 1.59
  
• d1lyb.2 appears in the current release, SCOPe 2.08