SCOPe 2.08: Domain d4oe7b_: 4oe7 B:

Lineage for d4oe7b_ (4oe7 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (94 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [226105] (8 PDB entries)

8. Domain d4oe7b_: 4oe7 B: [268506]
   automated match to d2v9da_
   complexed with edo, gol, gxp, gxs, gxt, mg, pyr

Details for d4oe7b_

PDB Entry: 4oe7, 1.99 Å

PDB Description: crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal

PDB Compounds: (B:) Probable 2-keto-3-deoxy-galactonate aldolase YagE

SCOPe Domain Sequences for d4oe7b_:

Sequence; same for both SEQRES and ATOM records:

>d4oe7b_ c.1.10.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
alftgiippvstiftadgqldkpgtaaliddlikagvdglfflgsggefsqlgaeerkai
arfaidhvdrrvpvligtggtnaretielsqhaqqagadgivvinpyywkvseanliryf
eqvadsvtlpvmlynfpaltgqdltpalvktladsrsniigikdtidsvahlrsmihtvk
gahphftvlcgyddhlfntlllggdgaisasgnfapqvsvnllkawrdgdvakaagyhqt
llqipqmyqldtpfvnvikeaivlcgrpvsthvlppaspldeprkaqlktllqqlklc

Timeline for d4oe7b_:

• d4oe7b_ first appeared in SCOPe 2.05
  
• d4oe7b_ appears in SCOPe 2.07