Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) |
Family c.1.18.0: automated matches [191539] (1 protein) not a true family |
Protein automated matches [190919] (11 species) not a true protein |
Species Thermococcus kodakarensis [TaxId:69014] [268487] (1 PDB entry) |
Domain d4oecb_: 4oec B: [268504] automated match to d2pz0b_ complexed with mg |
PDB Entry: 4oec (more details), 1.9 Å
SCOPe Domain Sequences for d4oecb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oecb_ c.1.18.0 (B:) automated matches {Thermococcus kodakarensis [TaxId: 69014]} mwerdrvivlghrgymsnypentllafrkaveagadgieldvwltkdgrvvvmhdetidr tsnmkgrqkdmtleelkkadvgqgeriptleevfeaiprnalvnvelkdrdaarevaeiv aennpervmissfdidalreyrkyddettmgllidreevvplipklkdelnlwsvnvpme aipliglektlqalhwvrslglkvvlwtendvlfykddnlaklkglfevviandvvrmie ylkklglr
Timeline for d4oecb_: