SCOPe 2.07: Domain d4oecb_: 4oec B:

Lineage for d4oecb_ (4oec B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families)

5. Family c.1.18.0: automated matches [191539] (1 protein)
   not a true family

6. Protein automated matches [190919] (11 species)
   not a true protein

7. Species Thermococcus kodakarensis [TaxId:69014] [268487] (1 PDB entry)

8. Domain d4oecb_: 4oec B: [268504]
   automated match to d2pz0b_
   complexed with mg

Details for d4oecb_

PDB Entry: 4oec, 1.9 Å

PDB Description: crystal structure of glycerophosphodiester phosphodiesterase from thermococcus kodakarensis kod1

PDB Compounds: (B:) Glycerophosphoryl diester phosphodiesterase

SCOPe Domain Sequences for d4oecb_:

Sequence; same for both SEQRES and ATOM records:

>d4oecb_ c.1.18.0 (B:) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
mwerdrvivlghrgymsnypentllafrkaveagadgieldvwltkdgrvvvmhdetidr
tsnmkgrqkdmtleelkkadvgqgeriptleevfeaiprnalvnvelkdrdaarevaeiv
aennpervmissfdidalreyrkyddettmgllidreevvplipklkdelnlwsvnvpme
aipliglektlqalhwvrslglkvvlwtendvlfykddnlaklkglfevviandvvrmie
ylkklglr

Timeline for d4oecb_:

• d4oecb_ first appeared in SCOPe 2.05
  
• d4oecb_ appears in SCOPe 2.06
  
• d4oecb_ appears in the current release, SCOPe 2.08