Lineage for d4o7ub_ (4o7u B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212073Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2212074Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2212075Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2212382Protein automated matches [190469] (15 species)
    not a true protein
  7. 2212409Species Enterococcus faecalis [TaxId:1351] [194752] (3 PDB entries)
  8. 2212415Domain d4o7ub_: 4o7u B: [268460]
    automated match to d3uwlb_
    complexed with edo, so4, ss7, thf

Details for d4o7ub_

PDB Entry: 4o7u (more details), 2.4 Å

PDB Description: etherocomplex of enteroccocus faecalis thymidylate synthase with 5- hydroxymethilene-6-hydrofolic acid and the phtalimidic inhibitor ss7
PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d4o7ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o7ub_ d.117.1.1 (B:) automated matches {Enterococcus faecalis [TaxId: 1351]}
meeaylalgkkileeghfkedrtgtgtyslfgyqmrfdlakgfpllttkrvpfgliksel
lwflkgdtniryllernnhiwdewaferyvksadyqgpdmtdfghrvlqdpafaeqykee
hqkfcdailndaefaekygelgniygaqwrhwetkdgsfidqlanviemiktnpdsrrli
vsawnpedvpsmalppchtmfqfyvnegklscqlyqrsadvflgvpfniasyallthlia
hetglevgefvhtlgdahlyqnhveqmqeqlsrevrsfptlvlnpdkasvfdfdmedikv
egydphptikapiav

SCOPe Domain Coordinates for d4o7ub_:

Click to download the PDB-style file with coordinates for d4o7ub_.
(The format of our PDB-style files is described here.)

Timeline for d4o7ub_: