Lineage for d4o53a_ (4o53 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1815293Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1815651Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 1815652Protein automated matches [190605] (17 species)
    not a true protein
  7. 1815730Species Trichomonas vaginalis [TaxId:5722] [195009] (11 PDB entries)
  8. 1815739Domain d4o53a_: 4o53 A: [268459]
    automated match to d3qsra_
    complexed with na; mutant

Details for d4o53a_

PDB Entry: 4o53 (more details), 2 Å

PDB Description: crystal structure of trichomonas vaginalis triosephosphate isomerase ile45-leu mutant (tvag_497370)
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d4o53a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o53a_ c.1.1.0 (A:) automated matches {Trichomonas vaginalis [TaxId: 5722]}
rtffvggnwkanpktveeaekliemlngakvegnvevvvaapflflptlqqklrkdwkvs
aenvftkpngaftgevtvpmiksfgiewtilghserrdilkeddeflaakakfalengmk
iiyccgehlsereagkasefvsaqiekmipaipagkwddvviayepiwaigtgkvastqd
aqemckvirdilaakvgadiankvrilyggsvkpnncnelaacpdvdgflvggaslepgf
inivnsnvhsk

SCOPe Domain Coordinates for d4o53a_:

Click to download the PDB-style file with coordinates for d4o53a_.
(The format of our PDB-style files is described here.)

Timeline for d4o53a_: