![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) ![]() |
![]() | Family c.1.1.0: automated matches [191424] (1 protein) not a true family |
![]() | Protein automated matches [190605] (21 species) not a true protein |
![]() | Species Trichomonas vaginalis [TaxId:5722] [195009] (11 PDB entries) |
![]() | Domain d4o53a_: 4o53 A: [268459] automated match to d3qsra_ complexed with na; mutant |
PDB Entry: 4o53 (more details), 2 Å
SCOPe Domain Sequences for d4o53a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o53a_ c.1.1.0 (A:) automated matches {Trichomonas vaginalis [TaxId: 5722]} rtffvggnwkanpktveeaekliemlngakvegnvevvvaapflflptlqqklrkdwkvs aenvftkpngaftgevtvpmiksfgiewtilghserrdilkeddeflaakakfalengmk iiyccgehlsereagkasefvsaqiekmipaipagkwddvviayepiwaigtgkvastqd aqemckvirdilaakvgadiankvrilyggsvkpnncnelaacpdvdgflvggaslepgf inivnsnvhsk
Timeline for d4o53a_: