Lineage for d4o1nd2 (4o1n D:102-202)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2541472Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2541693Family d.15.6.0: automated matches [227139] (1 protein)
    not a true family
  6. 2541694Protein automated matches [226841] (6 species)
    not a true protein
  7. 2541725Species Staphylococcus aureus [TaxId:93061] [226096] (8 PDB entries)
  8. 2541740Domain d4o1nd2: 4o1n D:102-202 [268434]
    Other proteins in same PDB: d4o1na1, d4o1nb1, d4o1nc1, d4o1nd1, d4o1ne1, d4o1nf1
    automated match to d2z8la2
    complexed with gol

Details for d4o1nd2

PDB Entry: 4o1n (more details), 2.5 Å

PDB Description: Crystal structure of Staphylococcal superantigen-like protein SAOUHSC_00383
PDB Compounds: (D:) Superantigen-like protein

SCOPe Domain Sequences for d4o1nd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o1nd2 d.15.6.0 (D:102-202) automated matches {Staphylococcus aureus [TaxId: 93061]}
qyidyintpileikkdnedvlkdfyyiskedislkeldyrlreraikqhglysnglkqgq
ititmndgtthtidlsqklekermgesidgtkinkilvemk

SCOPe Domain Coordinates for d4o1nd2:

Click to download the PDB-style file with coordinates for d4o1nd2.
(The format of our PDB-style files is described here.)

Timeline for d4o1nd2: