| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
| Protein automated matches [226903] (39 species) not a true protein |
| Species Haemophilus influenzae [TaxId:71421] [268351] (10 PDB entries) |
| Domain d4mv9a1: 4mv9 A:1-114 [268364] Other proteins in same PDB: d4mv9a2, d4mv9a3 automated match to d3rv3a1 complexed with bct, edo |
PDB Entry: 4mv9 (more details), 1.98 Å
SCOPe Domain Sequences for d4mv9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mv9a1 c.30.1.0 (A:1-114) automated matches {Haemophilus influenzae [TaxId: 71421]}
mlekvvianrgeialrilrackelgiktvavhstadrdlkhvlladeticigpapsaksy
lnipaiiaaaevtgadaihpgygflsenadfaeqversgftfigptadvirlmg
Timeline for d4mv9a1: