| Class b: All beta proteins [48724] (177 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
| Family b.84.2.0: automated matches [254217] (1 protein) not a true family |
| Protein automated matches [254496] (13 species) not a true protein |
| Species Haemophilus influenzae [TaxId:71421] [268355] (8 PDB entries) |
| Domain d4mv7a3: 4mv7 A:331-444 [268363] Other proteins in same PDB: d4mv7a1, d4mv7a2 automated match to d2w6za3 complexed with edo, ppf |
PDB Entry: 4mv7 (more details), 1.73 Å
SCOPe Domain Sequences for d4mv7a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mv7a3 b.84.2.0 (A:331-444) automated matches {Haemophilus influenzae [TaxId: 71421]}
kghamecrinaedpktflpspgkvnhlhspgglgvrwdshvyggytvpphydsmiaklit
ygdtrevairrmqnalsetiidgiktniplheliledenfqkggtnihylekkl
Timeline for d4mv7a3: