Lineage for d4apre_ (4apr E:)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily) Superfamily b.50.1: Acid proteases [50630] (2 families) 
Family b.50.1.2: Pepsin-like [50646] (9 proteins) Protein Acid protease [50649] (7 species) 
Species Bread mold (Rhizopus chinensis) [TaxId:4843] [50651] (5 PDB entries) 
Domain d4apre_: 4apr E: [26823]
Details for d4apre_
PDB Entry: 4apr (more details), 2.5 Å
PDB Description: structures of complexes of rhizopuspepsin with pepstatin and other statine-containing inhibitors
SCOP Domain Sequences for d4apre_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4apre_ b.50.1.2 (E:) Acid protease {Bread mold (Rhizopus chinensis)}
agvgtvpmtdygndieyygqvtigtpgkkfnldfdtgssdlwiastlctncgsgqtkydp
nqsstyqadgrtwsisygdgssasgilakdnvnlggllikgqtielakreaasfasgpnd
gllglgfdtittvrgvktpmdnlisqglisrpifgvylgkaknggggeyifggydstkfk
gslttvpidnsrgwwgitvdratvgtstvassfdgildtgttllilpnniaasvarayga
sdngdgtytiscdtsafkplvfsingasfqvspdslvfeefqgqciagfgygnwgfaiig
dtflknnyvvfnqgvpevqiapvae
SCOP Domain Coordinates for d4apre_:
Click to download the PDB-style file with coordinates for d4apre_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4apre_:
- d4apre_ first appeared (with stable ids) in SCOP 1.55
- d4apre_ appears in SCOP 1.57
- d4apre_ appears in SCOP 1.61
- d4apre_ appears in the current release, SCOPe 2.08
View in 3D