Lineage for d5apre_ (5apr E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2800798Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2800799Protein Acid protease [50649] (9 species)
  7. 2800814Species Bread mold (Rhizopus chinensis) [TaxId:4843] [50651] (8 PDB entries)
    Uniprot P06026 69-393
  8. 2800820Domain d5apre_: 5apr E: [26821]
    complexed with ca

Details for d5apre_

PDB Entry: 5apr (more details), 2.1 Å

PDB Description: structures of complexes of rhizopuspepsin with pepstatin and other statine-containing inhibitors
PDB Compounds: (E:) rhizopuspepsin

SCOPe Domain Sequences for d5apre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5apre_ b.50.1.2 (E:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]}
agvgtvpmtdygndieyygqvtigtpgkkfnldfdtgssdlwiastlctncgsgqtkydp
nqsstyqadgrtwsisygdgssasgilakdnvnlggllikgqtielakreaasfasgpnd
gllglgfdtittvrgvktpmdnlisqglisrpifgvylgkaknggggeyifggydstkfk
gslttvpidnsrgwwgitvdratvgtstvassfdgildtgttllilpnniaasvarayga
sdngdgtytiscdtsafkplvfsingasfqvspdslvfeefqgqciagfgygnwgfaiig
dtflknnyvvfnqgvpevqiapvae

SCOPe Domain Coordinates for d5apre_:

Click to download the PDB-style file with coordinates for d5apre_.
(The format of our PDB-style files is described here.)

Timeline for d5apre_: