Class b: All beta proteins [48724] (180 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
Protein Acid protease [50649] (9 species) |
Species Bread mold (Rhizopus chinensis) [TaxId:4843] [50651] (8 PDB entries) Uniprot P06026 69-393 |
Domain d5apre_: 5apr E: [26821] complexed with ca |
PDB Entry: 5apr (more details), 2.1 Å
SCOPe Domain Sequences for d5apre_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5apre_ b.50.1.2 (E:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} agvgtvpmtdygndieyygqvtigtpgkkfnldfdtgssdlwiastlctncgsgqtkydp nqsstyqadgrtwsisygdgssasgilakdnvnlggllikgqtielakreaasfasgpnd gllglgfdtittvrgvktpmdnlisqglisrpifgvylgkaknggggeyifggydstkfk gslttvpidnsrgwwgitvdratvgtstvassfdgildtgttllilpnniaasvarayga sdngdgtytiscdtsafkplvfsingasfqvspdslvfeefqgqciagfgygnwgfaiig dtflknnyvvfnqgvpevqiapvae
Timeline for d5apre_: