SCOP 1.57: Domain d2web__: 2web -

Lineage for d2web__ (2web -)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.2: Pepsin-like [50646] (9 proteins)

6. Protein Acid protease [50649] (7 species)

7. Species Fungus (Penicillium janthinellum), penicillopepsin [TaxId:5079] [50650] (14 PDB entries)

8. Domain d2web__: 2web - [26809]

Details for d2web__

PDB Entry: 2web, 1.5 Å

PDB Description: acid proteinase (penicillopepsin) (e.c.3.4.23.20) complex with phosphonate inhibitor: methyl(2s)-[1-(((n-formyl)-l-valyl)amino-2-(2- naphthyl)ethyl)hydroxyphosphinyloxy]-3-phenylpropanoate, sodium salt

SCOP Domain Sequences for d2web__:

Sequence; same for both SEQRES and ATOM records:

>d2web__ b.50.1.2 (-) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin}
aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps
atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg
llglafssintvqpqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt
ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds
naggyvfdcstnlpdfsvsisgytatvpgslinygpsgdgstclggiqsnsgigfsifgd
iflksqyvvfdsdgpqlgfapqa

Timeline for d2web__:

• d2web__ first appeared (with stable ids) in SCOP 1.55
  
• d2web__ appears in SCOP 1.59
  
• d2web__ appears in the current release, SCOPe 2.08, called d2weba_