SCOPe 2.08: Domain d2weba_: 2web A:

Lineage for d2weba_ (2web A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Acid protease [50649] (9 species)

7. Species Fungus (Penicillium janthinellum), penicillopepsin [TaxId:5079] [50650] (14 PDB entries)

8. Domain d2weba_: 2web A: [26809]
   complexed with man, pp4, so4

Details for d2weba_

PDB Entry: 2web, 1.5 Å

PDB Description: acid proteinase (penicillopepsin) (e.c.3.4.23.20) complex with phosphonate inhibitor: methyl(2s)-[1-(((n-formyl)-l-valyl)amino-2-(2- naphthyl)ethyl)hydroxyphosphinyloxy]-3-phenylpropanoate, sodium salt

PDB Compounds: (A:) penicillopepsin

SCOPe Domain Sequences for d2weba_:

Sequence; same for both SEQRES and ATOM records:

>d2weba_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]}
aasgvatntptandeeyitpvtiggttlnlnfdtgsadlwvfstelpasqqsghsvynps
atgkelsgytwsisygdgssasgnvftdsvtvggvtahgqavqaaqqisaqfqqdtnndg
llglafssintvqpqsqttffdtvksslaqplfavalkhqqpgvydfgfidsskytgslt
ytgvdnsqgfwsfnvdsytagsqsgdgfsgiadtgttllllddsvvsqyysqvsgaqqds
naggyvfdcstnlpdfsvsisgytatvpgslinygpsgdgstclggiqsnsgigfsifgd
iflksqyvvfdsdgpqlgfapqa

Timeline for d2weba_:

• d2weba_ first appeared (with stable ids) in SCOP 1.55, called d2web__
  
• d2weba_ appears in SCOPe 2.07