Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (52 species) not a true protein |
Species Trypanosoma brucei [TaxId:31285] [268052] (8 PDB entries) |
Domain d3wxjd2: 3wxj D:263-511 [268078] Other proteins in same PDB: d3wxja3, d3wxjb3, d3wxjc3, d3wxjd3 automated match to d3h46o2 complexed with g3p, gol |
PDB Entry: 3wxj (more details), 2.7 Å
SCOPe Domain Sequences for d3wxjd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wxjd2 c.55.1.0 (D:263-511) automated matches {Trypanosoma brucei [TaxId: 31285]} mcfekgeakntygtgcfllmnvgeearfskhgllstvgfqvgrdgpcyyalegaiacaga tvewmrrnmnlfshiteceklarsvpgtqgivfvpafsgllapywdpsargtivgmtlkt trahviraalqaialqlndvvgsmkrdaglnlsslrvdgglskngllmeiqasllgvdil vpsmhettalgaalcaglaagvwtsleevkavsrrenswktvspsgsamereamiaewre alkrtkwak
Timeline for d3wxjd2: