Lineage for d1ente_ (1ent E:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 168884Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 168885Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 169255Family b.50.1.2: Pepsin-like [50646] (9 proteins)
  6. 169336Protein Endothiapepsin [50647] (1 species)
  7. 169337Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (32 PDB entries)
  8. 169348Domain d1ente_: 1ent E: [26786]

Details for d1ente_

PDB Entry: 1ent (more details), 1.9 Å

PDB Description: x-ray analyses of aspartic proteinases. the three-dimensional structure at 2.1 angstroms resolution of endothiapepsin

SCOP Domain Sequences for d1ente_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ente_ b.50.1.2 (E:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica)}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOP Domain Coordinates for d1ente_:

Click to download the PDB-style file with coordinates for d1ente_.
(The format of our PDB-style files is described here.)

Timeline for d1ente_: