SCOPe 2.08: Domain d1fmba_: 1fmb A:

Lineage for d1fmba_ (1fmb A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein EIAV protease [50644] (1 species)

7. Species Equine infectious anemia virus [TaxId:11665] [50645] (2 PDB entries)

8. Domain d1fmba_: 1fmb A: [26777]
   protein/DNA complex; protein/RNA complex; complexed with hyb

Details for d1fmba_

PDB Entry: 1fmb, 1.8 Å

PDB Description: eiav protease complexed with the inhibitor hby-793

PDB Compounds: (A:) eiav protease

SCOPe Domain Sequences for d1fmba_:

Sequence; same for both SEQRES and ATOM records:

>d1fmba_ b.50.1.1 (A:) EIAV protease {Equine infectious anemia virus [TaxId: 11665]}
vtynlekrpttivlindtplnvlldtgadtsvlttahynrlkyrgrkyqgtgiggvggnv
etfstpvtikkkgrhiktrmlvadipvtilgrdilqdlgaklvl

Timeline for d1fmba_:

• d1fmba_ first appeared (with stable ids) in SCOP 1.55, called d1fmb__
  
• d1fmba_ appears in SCOPe 2.07