Lineage for d1siva_ (1siv A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1548217Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1548218Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1548219Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1549373Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)
  7. 1549374Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (7 PDB entries)
  8. 1549380Domain d1siva_: 1siv A: [26758]
    complexed with psi

Details for d1siva_

PDB Entry: 1siv (more details), 2.5 Å

PDB Description: three-dimensional structure of a siv protease(slash)inhibitor complex. implications for the design of hiv-1 and hiv-2 protease inhibitors
PDB Compounds: (A:) siv protease

SCOPe Domain Sequences for d1siva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1siva_ b.50.1.1 (A:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains [TaxId: 11723]}
pqfslwrrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
nvkievlgkrikgtimtgdtpinifgrnlltalgmslnl

SCOPe Domain Coordinates for d1siva_:

Click to download the PDB-style file with coordinates for d1siva_.
(The format of our PDB-style files is described here.)

Timeline for d1siva_: