Lineage for d4v194_ (4v19 4:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3043573Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 3043618Protein Eukaryotic, mitochondrial (54S or 39S subunit) [267635] (2 species)
  7. 3043656Species Pig (Sus scrofa) [TaxId:9823] [267696] (2 PDB entries)
  8. 3043684Domain d4v194_: 4v19 4: [267521]
    complexed with mg, zn

Details for d4v194_

PDB Entry: 4v19 (more details), 3.4 Å

PDB Description: structure of the large subunit of the mammalian mitoribosome, part 1 of 2
PDB Compounds: (4:) mitoribosomal protein bl31m, mrpl55

SCOPe Domain Sequences for d4v194_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4v194_ i.1.1.2 (4:) Eukaryotic, mitochondrial (54S or 39S subunit) {Pig (Sus scrofa) [TaxId: 9823]}
dcnralltrlhrqtyarlypvllvkqdgstihiryreprrmltmp

SCOPe Domain Coordinates for d4v194_:

Click to download the PDB-style file with coordinates for d4v194_.
(The format of our PDB-style files is described here.)

Timeline for d4v194_: