| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.2: Large subunit [58124] (3 proteins) |
| Protein Eukaryotic, mitochondrial (54S or 39S subunit) [267635] (2 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [267696] (2 PDB entries) |
| Domain d4v19u_: 4v19 U: [267540] complexed with mg, zn |
PDB Entry: 4v19 (more details), 3.4 Å
SCOPe Domain Sequences for d4v19u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4v19u_ i.1.1.2 (U:) Eukaryotic, mitochondrial (54S or 39S subunit) {Pig (Sus scrofa) [TaxId: 9823]}
lrsrvtdrywrvqevlkharhfrgrknrcyrlavravtrafvkctrarrlkkrslrtlwi
nritaasqehglkypafiinlikcqvelnrkvladlaiyepktfkslaalakrrreegfa
aalgdgkepdgifsrvvqhr
Timeline for d4v19u_:
View in 3DDomains from other chains: (mouse over for more information) d4v190_, d4v191_, d4v192_, d4v193_, d4v194_, d4v195_, d4v196_, d4v197_, d4v198_, d4v199_, d4v19d_, d4v19e_, d4v19f_, d4v19i_, d4v19j_, d4v19k_, d4v19n_, d4v19o_, d4v19p_, d4v19q_, d4v19r_, d4v19s_, d4v19t_, d4v19v_, d4v19w_, d4v19x_, d4v19y_ |