Lineage for d1ytga_ (1ytg A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 562942Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 562943Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 562944Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 563367Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)
  7. 563368Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (14 PDB entries)
  8. 563382Domain d1ytga_: 1ytg A: [26750]

Details for d1ytga_

PDB Entry: 1ytg (more details), 2.3 Å

PDB Description: siv protease crystallized with peptide product

SCOP Domain Sequences for d1ytga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytga_ b.50.1.1 (A:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf

SCOP Domain Coordinates for d1ytga_:

Click to download the PDB-style file with coordinates for d1ytga_.
(The format of our PDB-style files is described here.)

Timeline for d1ytga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ytgb_