SCOP 1.73: Domain d1az5a_: 1az5 A:

Lineage for d1az5a_ (1az5 A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)

7. Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (16 PDB entries)

8. Domain d1az5a_: 1az5 A: [26747]
   mutant

Details for d1az5a_

PDB Entry: 1az5, 2 Å

PDB Description: unliganded siv protease structure in an "open" conformation

PDB Compounds: (A:) siv protease

SCOP Domain Sequences for d1az5a_:

Sequence, based on SEQRES records:

>d1az5a_ b.50.1.1 (A:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains [TaxId: 11723]}
pqfhlwkrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
nvevevlgkrikgtimtgdtpinifgrnlltalgmslnf

Sequence, based on observed residues (ATOM records):

>d1az5a_ b.50.1.1 (A:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains [TaxId: 11723]}
pqfhlwkrpvvtahiegqpvevlldtgaddsivtgielgphytpkivgfintkeyknvev
evlgkrikgtimtgdtpinifgrnlltalgmslnf

Timeline for d1az5a_:

• d1az5a_ first appeared (with stable ids) in SCOP 1.55, called d1az5__
  
• d1az5a_ was called d1az5__ in SCOP 1.71
  
• d1az5a_ appears in SCOP 1.75
  
• d1az5a_ appears in the current release, SCOPe 2.08