Lineage for d4uofc_ (4uof C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557935Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2558476Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2558477Protein automated matches [191087] (19 species)
    not a true protein
  7. 2558689Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [259554] (3 PDB entries)
  8. 2558695Domain d4uofc_: 4uof C: [267456]
    automated match to d4uoha_
    complexed with dat, mg

Details for d4uofc_

PDB Entry: 4uof (more details), 2.1 Å

PDB Description: Crystallographic structure of nucleoside diphosphate kinase from Litopenaeus vannamei complexed with dADP
PDB Compounds: (C:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4uofc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uofc_ d.58.6.0 (C:) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
mvrertfiavkpdgvqrgligeiikrfeakgfklagmkyiqasedllkqhyidladkpfy
pglckymssgpvvamcwegtgvvktarvmmgetrpadskpgtirgdfcievgrniihgsd
svesankeialwfkpeelvswtqtneswiye

SCOPe Domain Coordinates for d4uofc_:

Click to download the PDB-style file with coordinates for d4uofc_.
(The format of our PDB-style files is described here.)

Timeline for d4uofc_: