Lineage for d1ivqa_ (1ivq A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1548217Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1548218Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1548219Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1549319Protein Human immunodeficiency virus type 2 (HIV-2) protease [50634] (2 species)
  7. 1549327Species Human immunodeficiency virus type 2 [TaxId:11709] [50635] (15 PDB entries)
  8. 1549354Domain d1ivqa_: 1ivq A: [26741]
    complexed with 0px

Details for d1ivqa_

PDB Entry: 1ivq (more details), 2.6 Å

PDB Description: the crystallographic structure of the protease from human immunodeficiency virus type 2 with two synthetic peptidic transition state analog inhibitors
PDB Compounds: (A:) hiv-2 protease

SCOPe Domain Sequences for d1ivqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivqa_ b.50.1.1 (A:) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2 [TaxId: 11709]}
pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyk
nveievlnkkvratimtgdtpinifgrniltalgmslnl

SCOPe Domain Coordinates for d1ivqa_:

Click to download the PDB-style file with coordinates for d1ivqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ivqa_: