Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins) barrel, closed; n=5, S=10 |
Protein automated matches [190206] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186959] (27 PDB entries) |
Domain d4r4ta1: 4r4t A:1-120 [267377] Other proteins in same PDB: d4r4ta2 automated match to d4ipca_ complexed with 3j0 |
PDB Entry: 4r4t (more details), 1.28 Å
SCOPe Domain Sequences for d4r4ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r4ta1 b.40.4.3 (A:1-120) automated matches {Human (Homo sapiens) [TaxId: 9606]} mvgqlsrgaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfmlat qlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvpyne
Timeline for d4r4ta1: