Lineage for d4qiif_ (4qii F:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2112573Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2112751Protein automated matches [190669] (6 species)
    not a true protein
  7. 2112789Species Mycobacterium tuberculosis [TaxId:83332] [261127] (2 PDB entries)
  8. 2112795Domain d4qiif_: 4qii F: [267321]
    automated match to d1rjnb_
    complexed with 2ne, pge

Details for d4qiif_

PDB Entry: 4qii (more details), 1.64 Å

PDB Description: Crystal Structure of type II MenB from Mycobacteria tuberculosis
PDB Compounds: (F:) 1,4-Dihydroxy-2-naphthoyl-CoA synthase

SCOPe Domain Sequences for d4qiif_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qiif_ c.14.1.3 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dnpfdakawrlvdgfddltdityhrhvddatvrvafnrpevrnafrphtvdelyrvldha
rmspdvgvvlltgngpspkdggwafcsggdqrirgrsgyqyasgdtadtvdvaragrlhi
levqrlirfmpkvviclvngwaaggghslhvvcdltlasreyarfkqtdadvgsfdggyg
saylarqvgqkfareifflgrtytaeqmhqmgavnavaehaeletvglqwaaeinakspq
aqrmlkfafnllddglvgqqlfageatrlaymtdeavegrdaflqkrppdwspfpryf

SCOPe Domain Coordinates for d4qiif_:

Click to download the PDB-style file with coordinates for d4qiif_.
(The format of our PDB-style files is described here.)

Timeline for d4qiif_: