SCOPe 2.05: Domain d4qf3a_: 4qf3 A:

Lineage for d4qf3a_ (4qf3 A:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.0: automated matches [191482] (1 protein)
   not a true family

6. Protein automated matches [190772] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187998] (20 PDB entries)

8. Domain d4qf3a_: 4qf3 A: [267304]
   automated match to d4q6fa_
   complexed with zn

Details for d4qf3a_

PDB Entry: 4qf3, 1.6 Å

PDB Description: crystal structure of human baz2b phd zinc finger in the free form

PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2B

SCOPe Domain Sequences for d4qf3a_:

Sequence; same for both SEQRES and ATOM records:

>d4qf3a_ g.50.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msimkvycqicrkgdneellllcdgcdkgchtychrpkittipdgdwfcpaciakas

Timeline for d4qf3a_:

• d4qf3a_ is new in SCOPe 2.05-stable
  
• d4qf3a_ is called d4qf3a1 in SCOPe 2.06
  
• d4qf3a_ appears in the current release, SCOPe 2.08, called d4qf3a1