Lineage for d4qf3a1 (4qf3 A:1928-1983)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2588901Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 2588902Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 2589001Family g.50.1.0: automated matches [191482] (1 protein)
    not a true family
  6. 2589002Protein automated matches [190772] (6 species)
    not a true protein
  7. 2589007Species Human (Homo sapiens) [TaxId:9606] [187998] (26 PDB entries)
  8. 2589015Domain d4qf3a1: 4qf3 A:1928-1983 [267304]
    Other proteins in same PDB: d4qf3a2, d4qf3b2
    automated match to d4q6fa_
    complexed with zn

Details for d4qf3a1

PDB Entry: 4qf3 (more details), 1.6 Å

PDB Description: crystal structure of human baz2b phd zinc finger in the free form
PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2B

SCOPe Domain Sequences for d4qf3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qf3a1 g.50.1.0 (A:1928-1983) automated matches {Human (Homo sapiens) [TaxId: 9606]}
simkvycqicrkgdneellllcdgcdkgchtychrpkittipdgdwfcpaciakas

SCOPe Domain Coordinates for d4qf3a1:

Click to download the PDB-style file with coordinates for d4qf3a1.
(The format of our PDB-style files is described here.)

Timeline for d4qf3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4qf3a2