Lineage for d4pj6b2 (4pj6 B:367-615)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917420Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1917421Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1918487Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 1918488Protein automated matches [190805] (14 species)
    not a true protein
  7. 1918507Species Human (Homo sapiens) [TaxId:9606] [188286] (36 PDB entries)
  8. 1918568Domain d4pj6b2: 4pj6 B:367-615 [267179]
    Other proteins in same PDB: d4pj6a1, d4pj6a3, d4pj6a4, d4pj6b1, d4pj6b3, d4pj6b4
    automated match to d4p8qa2
    complexed with lys, nag, zn

Details for d4pj6b2

PDB Entry: 4pj6 (more details), 2.96 Å

PDB Description: crystal structure of human insulin regulated aminopeptidase with lysine in active site
PDB Compounds: (B:) Leucyl-cystinyl aminopeptidase

SCOPe Domain Sequences for d4pj6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj6b2 d.92.1.0 (B:367-615) automated matches {Human (Homo sapiens) [TaxId: 9606]}
knlsqdvngtlvsiyavpekigqvhyalettvklleffqnyfeiqyplkkldlvaipdfe
agamenwglltfreetllydsntssmadrklvtkiiahelahqwfgnlvtmkwwndlwln
egfatfmeyfslekifkelssyedfldarfktmkkdslnsshpisssvqsseqieemfds
lsyfkgsslllmlktylsedvfqhavvlylhnhsyasiqsddlwdsfnevtnqtldvkrm
mktwtlqkg

SCOPe Domain Coordinates for d4pj6b2:

Click to download the PDB-style file with coordinates for d4pj6b2.
(The format of our PDB-style files is described here.)

Timeline for d4pj6b2: