![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
![]() | Protein automated matches [190805] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188286] (36 PDB entries) |
![]() | Domain d4pj6b2: 4pj6 B:367-615 [267179] Other proteins in same PDB: d4pj6a1, d4pj6a3, d4pj6a4, d4pj6b1, d4pj6b3, d4pj6b4 automated match to d4p8qa2 complexed with lys, nag, zn |
PDB Entry: 4pj6 (more details), 2.96 Å
SCOPe Domain Sequences for d4pj6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pj6b2 d.92.1.0 (B:367-615) automated matches {Human (Homo sapiens) [TaxId: 9606]} knlsqdvngtlvsiyavpekigqvhyalettvklleffqnyfeiqyplkkldlvaipdfe agamenwglltfreetllydsntssmadrklvtkiiahelahqwfgnlvtmkwwndlwln egfatfmeyfslekifkelssyedfldarfktmkkdslnsshpisssvqsseqieemfds lsyfkgsslllmlktylsedvfqhavvlylhnhsyasiqsddlwdsfnevtnqtldvkrm mktwtlqkg
Timeline for d4pj6b2:
![]() Domains from other chains: (mouse over for more information) d4pj6a1, d4pj6a2, d4pj6a3, d4pj6a4 |