SCOPe 2.07: Domain d4pclb_: 4pcl B:

Lineage for d4pclb_ (4pcl B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (81 species)
   not a true protein

7. Species Anaplasma phagocytophilum [TaxId:1217107] [257458] (2 PDB entries)

8. Domain d4pclb_: 4pcl B: [267154]
   automated match to d4pcaa_
   complexed with edo, mn, sam

Details for d4pclb_

PDB Entry: 4pcl, 1.85 Å

PDB Description: x-ray crystal structure of an o-methyltransferase from anaplasma phagocytophilum bound to sam and a manganese ion.

PDB Compounds: (B:) O-methyltransferase family protein

SCOPe Domain Sequences for d4pclb_:

Sequence; same for both SEQRES and ATOM records:

>d4pclb_ c.66.1.0 (B:) automated matches {Anaplasma phagocytophilum [TaxId: 1217107]}
lskqdeylnklfavdtegalkahktapselrmaqlgtvegqmlqllirmagihsivevgt
cvgfsaicmahalpskghiytiekdyenvvtanqnivnckledkitvlhgealaqlntlk
emapfdmifidankssylaylnwakmyirkgglivadntflfgsvfdehptekvssnaha
smrafndelankekylstiiptsegmmvsiklt

Timeline for d4pclb_:

• d4pclb_ first appeared in SCOPe 2.05
  
• d4pclb_ appears in SCOPe 2.06
  
• d4pclb_ appears in the current release, SCOPe 2.08