SCOPe 2.07: Domain d4o1jb_: 4o1j B:

Lineage for d4o1jb_ (4o1j B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)
   Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families)

5. Family c.53.2.0: automated matches [191506] (1 protein)
   not a true family

6. Protein automated matches [190830] (14 species)
   not a true protein

7. Species Sordaria macrospora [TaxId:5147] [267979] (2 PDB entries)

8. Domain d4o1jb_: 4o1j B: [266996]
   automated match to d3e2wd_
   complexed with cl, zn

Details for d4o1jb_

PDB Entry: 4o1j, 2.69 Å

PDB Description: crystal structures of two tetrameric beta-carbonic anhydrases from the filamentous ascomycete sordaria macrospora.

PDB Compounds: (B:) carbonic anhydrase

SCOPe Domain Sequences for d4o1jb_:

Sequence; same for both SEQRES and ATOM records:

>d4o1jb_ c.53.2.0 (B:) automated matches {Sordaria macrospora [TaxId: 5147]}
ntfhyalssnnawagykahqnphffpklaggqapeilwigcsdsrcpettilgmqpgdvf
vhrnianivsptdinttavieyavahlkvkhivlcghsacggaagalsdgriggvldtwl
lplktvrynhaeeldaitdekerviriaqlnveagikvlmnnptireaiaerglevhgvf
fdigcgrikelgcgta

Timeline for d4o1jb_:

• d4o1jb_ first appeared in SCOPe 2.05
  
• d4o1jb_ appears in SCOPe 2.06
  
• d4o1jb_ appears in the current release, SCOPe 2.08