SCOP 1.69: Domain d1c6xa_: 1c6x A:

Lineage for d1c6xa_ (1c6x A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (166 PDB entries)

8. Domain d1c6xa_: 1c6x A: [26694]

Details for d1c6xa_

PDB Entry: 1c6x, 2.5 Å

PDB Description: alternate binding site for the p1-p3 group of a class of potent hiv-1 protease inhibitors as a result of concerted structural change in 80's loop.

SCOP Domain Sequences for d1c6xa_:

Sequence; same for both SEQRES and ATOM records:

>d1c6xa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwqrpvvtikiggqlmealidtgaddtvleemdlpgrwkpkiiggiggfvkvrqyd
qipieicghkvigtvlvgptptniigrnlltqigctlnf

Timeline for d1c6xa_:

• d1c6xa_ first appeared (with stable ids) in SCOP 1.55
  
• d1c6xa_ appears in SCOP 1.67
  
• d1c6xa_ appears in SCOP 1.71
  
• d1c6xa_ appears in the current release, SCOPe 2.08