Lineage for d1c6xa_ (1c6x A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15696Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 15712Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 15713Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (108 PDB entries)
  8. 15905Domain d1c6xa_: 1c6x A: [26694]

Details for d1c6xa_

PDB Entry: 1c6x (more details), 2.5 Å

PDB Description: alternate binding site for the p1-p3 group of a class of potent hiv-1 protease inhibitors as a result of concerted structural change in 80's loop.

SCOP Domain Sequences for d1c6xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c6xa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwqrpvvtikiggqlmealidtgaddtvleemdlpgrwkpkiiggiggfvkvrqyd
qipieicghkvigtvlvgptptniigrnlltqigctlnf

SCOP Domain Coordinates for d1c6xa_:

Click to download the PDB-style file with coordinates for d1c6xa_.
(The format of our PDB-style files is described here.)

Timeline for d1c6xa_: