Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.0: automated matches [191580] (1 protein) not a true family |
Protein automated matches [191036] (11 species) not a true protein |
Species Escherichia coli [TaxId:405955] [188925] (4 PDB entries) |
Domain d4nfxf_: 4nfx F: [266925] automated match to d3dkua_ |
PDB Entry: 4nfx (more details), 2.69 Å
SCOPe Domain Sequences for d4nfxf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nfxf_ d.113.1.0 (F:) automated matches {Escherichia coli [TaxId: 405955]} mfkphvtvacvvhaegkflvveetingkalwnqpaghleadetlveaaarelweetgisa qpqhfirmhqwiapdktpflrflfaieleqicptqphdsdidccrwvsaeeilqasnlrs plvaesircyqsgqryplemigdfnwpftkgvi
Timeline for d4nfxf_: