Lineage for d4mtqa_ (4mtq A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549433Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2549434Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2549945Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2549946Protein automated matches [190239] (26 species)
    not a true protein
  7. 2550047Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [259805] (4 PDB entries)
  8. 2550054Domain d4mtqa_: 4mtq A: [266773]
    automated match to d4mtsa_
    complexed with ni, sin

Details for d4mtqa_

PDB Entry: 4mtq (more details), 2.17 Å

PDB Description: ni-bound gloa2
PDB Compounds: (A:) lactoylglutathione lyase

SCOPe Domain Sequences for d4mtqa_:

Sequence, based on SEQRES records: (download)

>d4mtqa_ d.32.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mrilhsmlrvadleaalefytraldmrllrrrdypegrftlafvgyqderaaaalelthn
wdrdgytqgdgyghlaievedaavtcararalgyrvtreaglmqhgrsviafledpdgyk
veliqkgt

Sequence, based on observed residues (ATOM records): (download)

>d4mtqa_ d.32.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mrilhsmlrvadleaalefytraldmrllrrrdypegrftlafvgyqderaaaalelthn
wdrdgytqgdgyghlaievedaavtcararalgyrvtrviafledpdgykveliqkgt

SCOPe Domain Coordinates for d4mtqa_:

Click to download the PDB-style file with coordinates for d4mtqa_.
(The format of our PDB-style files is described here.)

Timeline for d4mtqa_: