SCOPe 2.05: Domain d4msaa_: 4msa A:

Lineage for d4msaa_ (4msa A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (86 PDB entries)

8. Domain d4msaa_: 4msa A: [266759]
   automated match to d4lm1a_
   complexed with 2zm, ni

Details for d4msaa_

PDB Entry: 4msa, 1.62 Å

PDB Description: Crystal structure of PDE10A2 with fragment ZT0449 (5-nitro-1H-benzimidazole)

PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d4msaa_:

Sequence; same for both SEQRES and ATOM records:

>d4msaa_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agtsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfel
eklcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdl
dhrgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvlei
irkaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvt
kltandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqil
pptepllkacrdnlsqwekvirgeetatwi

Timeline for d4msaa_:

• d4msaa_ is new in SCOPe 2.05-stable
  
• d4msaa_ is called d4msaa1 in SCOPe 2.06
  
• d4msaa_ appears in the current release, SCOPe 2.08, called d4msaa1